SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094F7L3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094F7L3
Domain Number 1 Region: 120-500
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.36e-65
Family Ankyrin repeat 0.00000457
Further Details:      
 
Domain Number 2 Region: 61-142
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000876
Family Pseudo ankyrin repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A094F7L3
Sequence length 531
Comment (tr|A0A094F7L3|A0A094F7L3_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFY84693.1} KW=Complete proteome; Reference proteome OX=1420913 OS=Pseudogymnoascus sp. VKM F-4518 (FW-2643). GN=V500_09094 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MTKLATFSDLPPEIIHLILGHVESPHDLLSFLRVFPHLAPSLPLAQTHAAGKAWICAGER
DKETILHLTAEQGDSAMLAALLANPSTDPNRLATIPFSTFSPSTDGRTLGGRTFPGHNRT
PLSLAAHNGHLGAVQSLLAHPSTDASIAKRPTHMHTPLALAACAGHLAITTLLLARPETD
AESRGAALGWAAVNGHAAVVALLLARDDVDPNVEEHRTRHTPLALAATGGHCDVVAMLLA
REDVNTDAIGLEDFTPLCFAARMGHRDVVEMLLGHGGVDPNGRSATEMSPLMCAVSRGHG
EVVGVLLRREDVRVEQRDGQGKTALLWAVQLGRVEAMRMLLLRGDVDVNVRDSAGAPVMG
IVARRGRVDMLTLLTQRDDVDVSIRDGSGMSALALAASGGGVEAVAFLLRQGLDVNARDD
KGFTPLMLAAKRGRTAVVKMLMEFDGVDFHAKDVKGKSVLVAAAESGQVEVVALLLERGC
VDINARDRSGRTALAVAMDDKGRWAIDPLGEKSDYDAVAKLLLEYGGVVDI
Download sequence
Identical sequences A0A094F7L3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]