SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094GWC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094GWC2
Domain Number 1 Region: 144-231,290-357
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 9.32e-18
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A094GWC2
Sequence length 548
Comment (tr|A0A094GWC2|A0A094GWC2_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFZ07132.1} KW=Complete proteome; Reference proteome OX=1420914 OS=Pseudogymnoascus sp. VKM F-4519 (FW-2642). GN=V501_06756 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MASLGFGKAFRSAWHSLTSYDRHSDFDSPYRTGQHVPLAQSRHDPLTSVATDGSESRADI
SSPYLDDQASSASALNGNAFPPSPAYARNPGNTSPSPYSPGMRSSSAQKRQNDNNFAENT
SPGEIQMQAFQEGLPPPPPVAHSWRRMDKWAEENYEELFEELGEGCTSNDLNDLEHQLDC
SLPMDVRESLQVHDGQEVGGRPTGMIFGCMLLDCEEIVHEWRNWKTVNEQYLNAPSTSGP
TTPATALGGSSSAAPPKKPQQPQNPMWRQDLLAKQESQPPGAIQRVYAHPRWIPLARDWG
GNNLAVDLAPGPTGKWGQVILFGRDYDCKYVVSRSWASFLATVADDMNSGKWFIDEDTNE
LKLREFKTSHVEPGYLDILRWRSDQKYGRRGPRRRPQNGSAKGAGSPTGSPYDSPVAEIG
EPRGRSMQRFSGASPVSSPNRPNYPKSSPLSKVAEEIPSAQVASPLQGVVNTDVSSSSKP
LVEIGTPRGSDEEKRVKAMESLLDPPPTKDDKENVKVDSTAAADSKLNGNATKQATVEDD
SVMKTIEI
Download sequence
Identical sequences A0A094GWC2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]