SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094HB46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094HB46
Domain Number 1 Region: 866-995
Classification Level Classification E-value
Superfamily PX domain 1.83e-24
Family PX domain 0.00091
Further Details:      
 
Domain Number 2 Region: 417-564
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.27e-18
Family Regulator of G-protein signaling, RGS 0.0061
Further Details:      
 
Domain Number 3 Region: 1517-1601
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000339
Family Canonical RBD 0.0014
Further Details:      
 
Domain Number 4 Region: 1324-1430
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000163
Family Canonical RBD 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A094HB46
Sequence length 1620
Comment (tr|A0A094HB46|A0A094HB46_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFZ05541.1} KW=Complete proteome; Reference proteome OX=1420914 OS=Pseudogymnoascus sp. VKM F-4519 (FW-2642). GN=V501_08240 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
MALSRRDVILGGIAIFFAWGGVTSLIPSLRWTVWAFVAGILVTVLGLAAIVLTTTRGSSY
GSRSRIVRPRGPDFLGAETWREELAKLPSRQPYDPRPLYPESFLISASLDELLEYIVRDF
VKSWYSSISRNPSFTNEVDNGIRDALIDIRDRLLSIDLVEVVVERFVPILTAHFKDFYDA
ERVVRGKHLNRNVTESEELDLAIAAKYRDGKLHPAASLAYSDTRLVQQEHLRTLAKEIIP
KVVPDSLISSKVVSVLIEELVSCAVLFPVMQVTSDPDTWNQVMENYGRSMLQDRSTVRKL
RAALDQHASPAPKEKRSLPFPRLSPNDNERKFEKFIRAARKVNNLSDARRFRSEVSSQLK
RDSQLEAADSVYLRRLEIAKKILDQRVNHLASGNWSANGNNTPDFSSNNGPSSDLNNASL
VDILHDSSALSYFMEYMDRQRVMPLVQFWIVVDGFRNPLEEDPTDDDEVPPNLPPWTDAD
RLDLAQIHEAYLSRPELNISESSKQSVRTFLKAGKGASQEQYYAARRTILLAQTSALEKM
KGKYFDGFKKSDLFYKYLTSQEASKNTKASMSHNPFDDQDRPSLPPRIDTPQSLHPKPKA
VSRVSLRQPQRKIALHRASQSSADLPSMQRRNVMDLANSRRSLDGDGDSPLFDDDDADSE
ALAGSIQSLDQDMDHHDGPAAPDNQIVKAMEAALNDIMEDAPNVDDLRGSLFDNGDSPAT
SLLFGKAEVSPRNSIDVQSHDSSQKEGGRPNIASLGLVNTSSRIGVFTDDDLFGDEEKFL
SDEHDDPDEDKEDVTDQIHEAAPGDLGLAEAITVLTTDIERLIAQNAVVESLTRKAELTN
NTAELRILRKSKASLQREIRRKELQRQQYVVQESDNSLYGRSTIRIKSIMVGKDDDGREF
AIYVVEVQRKAGEQMIAASWAVTRRYSEFLELHQKLREKYPSVRHLDFPRRRMVMKLQSD
FLHKRRLALEKYLRGLLLLPDVCRSRDLRSFLSQSAIAPGTEAPSNLVDKQDMMTRFYNS
VTDGMEDILGNIPVLDQLSTAGQNLISAATNQLTTMPPLVSEDPMTAAEAEAELNAFENR
ELEPFVKPICDIFLEVFELNRGNNWLRGRAVVVVLHQLLGGTIERKVRESVKTLVLEDSI
MRYITLIKDTMWPGGKKREMVQRTAAQKAKTRTEASLMLATLIPDLVGNVVGRVNAQAAS
RRIFATLNNPRLNSHLMFTFLDEIVDVLFRGSLPAMDNQSPINHGLSSFPIDPQAFDADD
RISYSKLDQKFLLVADDGSEYEFDDALRRWIPLLDDELAAQQQAAYKVQGVDEEETVEDM
RRKRKKEYVNGEDDNGGRVVKAPKKAKAPLPPRPNTAVYVTGLPRDVTIDEVAEVFSRKC
GVIAEEIDSGHPRIKLYTDDSGAFKGDALIVFFKAPSVNMAITLLDDTDFRYSDLGGSGK
MRVMAADSSYKKTKVEEGAGSTSTVDKEAARERAKTSARDKAKIIKKTQKLDARLADWDD
DDPQVLYEAGPKPQKLVVLKHMFTLEELEEDPAAMLDIKEDIREECAKLGEVTNVVLFDL
EEAGVASVRFRDEVAAAECVRVMNGRSFAGQTVEAYLSEGKEGFKKSKAKVQEGEEGGVA
Download sequence
Identical sequences A0A094HB46

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]