SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094HDW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094HDW4
Domain Number 1 Region: 154-217
Classification Level Classification E-value
Superfamily XPC-binding domain 8.5e-21
Family XPC-binding domain 0.00031
Further Details:      
 
Domain Number 2 Region: 210-275
Classification Level Classification E-value
Superfamily UBA-like 8.6e-16
Family UBA domain 0.0012
Further Details:      
 
Domain Number 3 Region: 10-72
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000036
Family UBA domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A094HDW4
Sequence length 279
Comment (tr|A0A094HDW4|A0A094HDW4_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KFZ11589.1} KW=Complete proteome; Reference proteome OX=1420914 OS=Pseudogymnoascus sp. VKM F-4519 (FW-2642). GN=V501_04678 OC=Leotiomycetes incertae sedis; Pseudeurotiaceae; Pseudogymnoascus.
Sequence
PAGAGVSATNAPAPAQPQFNDPSALTIGAQRAEAVANLESMGFERASIDAAMRAAFFNPD
RAVEYLLNGIPEDLQREQRPAAPQAAAPAAGAGDAQSPPPAQPAAGEGEGINLFEAAAQA
GRGGAGGGARGANPFAAAAGAGAGAGAAGAQAGLGNLDWLRNNPQFQQLRQVVQQQPQML
EPILQSVGAGNPQLAQLIGQHPEQFLQLLGEEGEEGDALAPPGATQISVTPEESEAIERL
CGLGFERDLAIQAYFACDKNEELAANFLFEQPDEDDGQN
Download sequence
Identical sequences A0A094HDW4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]