SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094JJJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094JJJ5
Domain Number 1 Region: 4-161
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 1.7e-65
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.000000799
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A094JJJ5
Sequence length 163
Comment (tr|A0A094JJJ5|A0A094JJJ5_9GAMM) 5-(carboxyamino)imidazole ribonucleotide mutase {ECO:0000256|HAMAP-Rule:MF_01929} KW=Complete proteome; Reference proteome OX=1515746 OS=Shewanella mangrovi. GN=HR45_06905 OC=Shewanellaceae; Shewanella.
Sequence
MQALVAVVMGSKSDWPTMEAAAEIMDSLKVPYHVEVVSAHRTPDKLIDFAATAADKGFKV
IIGGAGGAAHLPGMLASKTRLPVLGVPVQSKALNGMDSLLSIVQMPKGIAVGTLAIGTAG
AFNAGLLACQILATQDDELAARLEAFRESQTRAVLDNPDPREA
Download sequence
Identical sequences A0A094JJJ5
WP_037441071.1.75290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]