SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094JNZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094JNZ0
Domain Number 1 Region: 9-149
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000131
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A094JNZ0
Sequence length 157
Comment (tr|A0A094JNZ0|A0A094JNZ0_9BACL) Uncharacterized protein {ECO:0000313|EMBL:KFZ40857.1} KW=Complete proteome; Reference proteome OX=1535750 OS=Thermoactinomyces sp. Gus2-1. GN=JS81_05470 OC=Thermoactinomyces.
Sequence
MISWAEQEEKIPDEQFAEIEEEIGVKLPKDYIHWVQQYAAPEDGNTYLLVDGKHYHFDAF
YPPDSIIEEFEALYFGEEEFKEFGLLVPFAFDGSLNHYCFYYRPGNLNPLILWKDKNDAL
EAIFDKNKLNNRVQIFGSSFTEFINALYHPAENIDSM
Download sequence
Identical sequences A0A094JNZ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]