SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094K3X9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094K3X9
Domain Number 1 Region: 71-334
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-70
Family Protein kinases, catalytic subunit 0.00000138
Further Details:      
 
Domain Number 2 Region: 2-94
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.71e-25
Family Regulator of G-protein signaling, RGS 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A094K3X9
Sequence length 336
Comment (tr|A0A094K3X9|A0A094K3X9_ANTCR) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=279965 OS=carolinensis). GN=N321_05115 OC=Antrostomus.
Sequence
AEYEIAPDEKLGEKGKEIMMKYLTPESPAYVPEVSQDLIQQTEEKLENSPCKELFSHCTK
SVLDHLSGEPFQEYLNSMYFDRFLQWKWLERQPVTKNTFRQYRVLGKGGFGEVCACQVRA
TGKMYACKRLEKKRIKKRKGESMALNEKQILEKVNSQFVVNLAYAYETKDALCLVLTIMN
GGDLKFHIYNMGNPGFEEERALFYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRI
SDLGLAVKIPEGESIRGRVGTVGYMAPEVLNNQRYTLSPDYWGLGCLIYEMIAGQSPFRG
RKEKVKREEVDRRVLETEEVYSHKFSEEAKSICKMV
Download sequence
Identical sequences A0A094K3X9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]