SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094KBD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094KBD0
Domain Number 1 Region: 76-215
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.1e-38
Family Regulator of G-protein signaling, RGS 0.00000033
Further Details:      
 
Domain Number 2 Region: 757-838
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.82e-27
Family DIX domain 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A094KBD0
Sequence length 838
Comment (tr|A0A094KBD0|A0A094KBD0_ANTCR) Axin-1 {ECO:0000313|EMBL:KFZ53521.1} KW=Complete proteome; Reference proteome OX=279965 OS=carolinensis). GN=N321_05833 OC=Antrostomus.
Sequence
MNIQGKGFPLDLGGSFTEDAPRPPVPGEEGELVSTDPRPVSHSFYSGKSDVVRNETSTAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLKQEDCADLLDFWFA
CSGFRKLEPCAANEEKRLKLAKAIYKKYILDNNDGQTTPATKSFIKDCVMKLQIDPDMFD
QAQTEIQCMIEDNTYPLFLKSDIYLEYTRTGGESPKIYSDPSSGSGTGKGLPGYLPTLNE
DEEWKCDQEAEPEASRDSAPSSRLTQKLLLETATQRAASARRYSEGREFRHGSWREPVNP
YYVNTGYALAPATSANDSEQQSMSSDADTMSLTDSSVDGIPPYRLRKQHRREMQESAKAN
GRVPLPHIPRTYRMPKDIHVEPEKFAAELINRLEEVQKEREAEEKLEERLKRVRAEEEGE
DADISSGPSVISHKMPSAQAFHHFAPRYSEMGCAGMQMRDAHEENPESILDEHVQRVMKT
PGCQSPGPGRHSPKPRSPESGHLGKLPGTLGTIPPGHGKHATKSGMKLDAANLYHHKHVY
HHIHHHSVMKPKEQIEAEATQRVQNSFAWNVDSHNYATKSRNYTENLGMAPVPMDSLGYS
GKASLLSKRNVKKTDSGKSDGASYEMPGSPEDVERNQKILQWIIEGEKEISRHKKTNHGS
SGAKKQLSHDMVRPLSIERPVAVHPWVSAQLRNVVQPSHPFIQDPTMPPNPAPNPLTQLE
EARRRLEEEEKRAGKLPLKQRLKPQKRPSSGASQPCENIVVAYYFCGEPIPYRTLVKGRV
VTLGQFKELLTKKGNYRYYFKKVSDEFDCGVVFEEVREDDTILPIFEEKIIGKVEKID
Download sequence
Identical sequences A0A094KBD0
XP_010161088.1.30499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]