SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094KCG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094KCG5
Domain Number 1 Region: 3-95
Classification Level Classification E-value
Superfamily TrpR-like 2.35e-33
Family Trp repressor, TrpR 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A094KCG5
Sequence length 105
Comment (tr|A0A094KCG5|A0A094KCG5_9BACI) Uncharacterized protein {ECO:0000313|EMBL:KFZ42466.1} KW=Complete proteome OX=1535751 OS=Anoxybacillus sp. KU2-6(11). GN=JS80_09870 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Anoxybacillus.
Sequence
MQINKLRGRELDQLFRAILSLKDLEECYRFFDDLCTVNEIQALAQRLEVARMLREGYTYH
KIETETGASTATISRVKRCLNYGNDAYAMALDRIYNEQQEEAGSQ
Download sequence
Identical sequences A0A094KCG5 A0A0A2SRN4 A0A0K6GPR5 A0A1V3FER9 A0A1X6ME12 A0A223FDL5 M5RCJ8 R4FH43
WP_006323616.1.13911 WP_006323616.1.19181 WP_006323616.1.1944 WP_006323616.1.19913 WP_006323616.1.31030 WP_006323616.1.31450 WP_006323616.1.34884 WP_006323616.1.60958 WP_006323616.1.68149 WP_006323616.1.72693 WP_006323616.1.74080 WP_006323616.1.83661 WP_006323616.1.92136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]