SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094KMF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094KMF3
Domain Number 1 Region: 371-559
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.9e-67
Family Regulator of G-protein signaling, RGS 0.0000067
Further Details:      
 
Domain Number 2 Region: 776-1004
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.01e-62
Family DBL homology domain (DH-domain) 0.00000000248
Further Details:      
 
Domain Number 3 Region: 1005-1140
Classification Level Classification E-value
Superfamily PH domain-like 2.54e-42
Family Pleckstrin-homology domain (PH domain) 0.00000208
Further Details:      
 
Domain Number 4 Region: 70-149
Classification Level Classification E-value
Superfamily PDZ domain-like 7.23e-22
Family PDZ domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A094KMF3
Sequence length 1303
Comment (tr|A0A094KMF3|A0A094KMF3_ANTCR) Rho guanine nucleotide exchange factor 12 {ECO:0000313|EMBL:KFZ60438.1} KW=Complete proteome; Reference proteome OX=279965 OS=carolinensis). GN=N321_14147 OC=Antrostomus.
Sequence
MSGTQSTVTDRFPLKKPTRHGSILSRESPADKKQKVERCSSTHDFDPADSSSKKTKSSSE
ESRSETYGLVQRCVVIQRDENGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNG
TLVTHSNHLEVVKLIKSGSYVALTVQGRPPGSPQIPLADSEVDLAAFGHMSPIMTSPHSP
GTSGNAERITSPVLVGEENNIVHNQKVEILRKMLQKEQERLQSLQEEYSRSPTTRLLKEI
QETKKHIPQLQEQLSKATGCTQVTGCVRLLCGVLGKQEFPAMLFCACTSKLHPLKLKLVI
RLAEVVKQYSAKSVYEIDFTMDFQIICGKTAFKTDSQSSVGSPLSRVGPQIIGAEDDDFD
TEQEQINGQCSCFQNIELLKSRPAHLAVLLHHVVSQFDPAALLCYLYTDLYKQTNSKETR
RVFLEFYQFFLDRAANLKVPVPDEISLELDRRRPELLPEELHRQFIQTMQDKVCPEVQRN
LEDFRQKRSMGLTLAEGELTKLDAERVRDRNAVEKERACAEQIIAKIEEVLMTSQPLEED
KSSTMQYVILTYMKHLGVKVKEPRNLEQKRGRIGFLPKIKQSIKKEKEGEEKGKRRGFPN
ILGPPRRPSRHDSSASMSDKEIYVPYLAMEMQKPRHPKHLPTASSVSPEPPDTSKMRQSG
SSSDGTDAPYPPANPMSPLAMGPFSSPEGSKDSETGLKQTGEAPPANDCMDGTPRTPNNT
FEFPSPLENLQEEEGESERMVDMGTPKPFRKMDSVGFTDVQSEDELYDFDMDMDPPNWQQ
LVSREVLLGLKPYEIKRQEVINELFYTERAHVRTLKVLHNVFYQRVTREGILNSSDKRKI
FSNLEDILGLHVALNDQMKAVRKRNETSVIGQIGEDLLSWFSGPAEEKLKHATATFCSNQ
PFALEVIKSRQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTEMQRLTKYPLLLDNIAKYT
ELPEEKEKVKKAADHCRQILNHVNQAVKESENKQHLEDYQRRLDLSYLKQSEDPMMDEFR
NLDLTKRKMLHEGPLIWKVNRDKTIDLYTLLLEDILVLLQKQDDKLVLKCHSKILASTAD
SKHTFSPVIKLNTVLVRQVATDNKAFFVISMSENGAHIYELVAQTVSEKNVWQDLIAQMA
GTMKMGSTRRVIPLPQSGPGEEEREEEEQQKLKEQHDIPASSLQSPDKDLGLESPLILNA
QSSSPIMSEKSKVESLLVSERQFDKVQQADLTLKDSSACYEHTTTSLSSVSEGQWALDAL
RNLGLLKQLLVQQLGFSEKGTLEDRQRFPRFRTISQEAQTESG
Download sequence
Identical sequences A0A094KMF3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]