SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094KSW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094KSW3
Domain Number 1 Region: 2-124
Classification Level Classification E-value
Superfamily SNARE-like 8.97e-31
Family Sedlin (SEDL) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A094KSW3
Sequence length 129
Comment (tr|A0A094KSW3|A0A094KSW3_ANTCR) Trafficking protein particle complex subunit 2-like {ECO:0000313|EMBL:KFZ61675.1} KW=Complete proteome; Reference proteome OX=279965 OS=carolinensis). GN=N321_10270 OC=Antrostomus.
Sequence
QNYPLYIRSVPTENELKFHYTVHTSLDVVDEKISAMGKALVDQRELYLGLLYPTEDYKVY
GYVTNSKVKFVMVVDSSNTALRDNEIRSMFRKLHNSYTDIMCNPFYNPGDRIHSRAFDNM
VNSMMMQVC
Download sequence
Identical sequences A0A091J9W2 A0A091P9V3 A0A091USG3 A0A091W4K9 A0A093I9D5 A0A093QC91 A0A094KSW3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]