SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094L1H4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094L1H4
Domain Number 1 Region: 1-72
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.5e-19
Family DEP domain 0.017
Further Details:      
 
Domain Number 2 Region: 190-254
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 5.62e-19
Family Transducin (heterotrimeric G protein), gamma chain 0.0026
Further Details:      
 
Domain Number 3 Region: 266-304
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000000442
Family Regulator of G-protein signaling, RGS 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A094L1H4
Sequence length 305
Comment (tr|A0A094L1H4|A0A094L1H4_9AVES) Regulator of G-protein signaling 6 {ECO:0000313|EMBL:KFZ64655.1} KW=Complete proteome; Reference proteome OX=345573 OS=Podiceps cristatus (great crested grebe). GN=N338_09526 OC=Podiceps.
Sequence
FLGADIVQWLMKNLSIEDPGEAIHLGSLIAAQGYVFPISDHVLTLKDDGTFYRFQAPYFW
PSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVK
IDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRMKNPQKVKKSVYGVTEE
SQPQSPVHVPSQPVRKTTKEDFRKQITFLNVQIERHCLKMSKVAESLIAYTEQYVEYDPF
ITPAEPSNPWISDDAALWDIEMSKEPSQQRVKRWGFSMDEVLKDPVGRDQFLRFLESEFS
SENLR
Download sequence
Identical sequences A0A094L1H4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]