SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094L8K5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094L8K5
Domain Number 1 Region: 110-249
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2.98e-48
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.0000143
Further Details:      
 
Domain Number 2 Region: 325-411
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.39e-26
Family Ubiquitin-related 0.00071
Further Details:      
 
Domain Number 3 Region: 1-108
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.78e-16
Family 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain 0.00094
Further Details:      
 
Domain Number 4 Region: 248-332
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000311
Family Ubiquitin-related 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A094L8K5
Sequence length 414
Comment (tr|A0A094L8K5|A0A094L8K5_ANTCR) 2'-5'-oligoadenylate synthase-like 1 {ECO:0000313|EMBL:KFZ60419.1} KW=Complete proteome; Reference proteome OX=279965 OS=carolinensis). GN=N321_14115 OC=Antrostomus.
Sequence
ADVVLFLSCFSNYQEQKQERQYILDLIRRRLHACRQRLTFTVNISEPRYKGPDNTPRSLS
LTLCSRERQVIQNVPPDAEVYVRLLDTSSEPGEFSPCFTELQKKFVKRYPAKLKNLLRLV
KHWYKEVVKPHYPTMNLPPNYALELLTIYAWEEGTNSCESFVMAEGFRTVLELLCRHQEI
CIYWEMYYSLQHSQIGAHVKRLLRSPRPVILDPADPTGILGQGKNWSLVAQEAASHLSLP
CVNTARPWNVQPARPVMIEVRQLVGTSLSRTVSPATTISQLKEEIKREWDIPWYRQRLAQ
QEPGSTLVLQDSKTLASYGIFYSTTLMLLQTEPQVMDIFVKDDKNRTTTYTVRPTDTVQQ
LKEQIHTRYGPPVHQQRLTYDSKELEDRHMLADYNVQPMSTIFMLLRLRGGMGP
Download sequence
Identical sequences A0A094L8K5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]