SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094LDP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094LDP0
Domain Number 1 Region: 99-439
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-88
Family Protein kinases, catalytic subunit 0.00000000000791
Further Details:      
 
Domain Number 2 Region: 466-574
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-25
Family Pleckstrin-homology domain (PH domain) 0.00000488
Further Details:      
 
Domain Number 3 Region: 1-96
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.06e-23
Family Regulator of G-protein signaling, RGS 0.00000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A094LDP0
Sequence length 600
Comment (tr|A0A094LDP0|A0A094LDP0_9AVES) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=345573 OS=Podiceps cristatus (great crested grebe). GN=N338_04306 OC=Podiceps.
Sequence
IKEYEKLDSEDERLTRSRQIYDTYIMKELLSCSHPFSKQAVDHVQTHLVKKQVPASLFQP
YIEEICDSLRGKIFQKFMESDKFTRFCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGC
RKADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMTYAFHTPDKLC
FILDLMNGGDLHYHLSQHGVFSEKEMRFYATEIILGLEHMHNRFVVYRDLKPANILLDEH
GHVRISDLGLACDFSKKKPHASVGTHGYMAPEVLQKGTAYDSSADWFSLGCMLFKLLRGH
SPFRQHKTKDKHEIDRMTLTVNVELPDSFSPELKSLLEGLLQRDVSKRLGCQGRSAQEVK
EHPFFKGIDWQQVYLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQELYKN
FPLVISERWQQEVAETVYDAVNADTDKIEARKRAKNKQLGHEEDYALGKDCIMHGYMLKL
GNPFLTQWQRRYFYLFPNRLEWRGEGESRQNLLTMEQIVSVEETQIKDKKCILLRIKGGK
QFVLQCESDPEFVQWKKELTEAFTEAQRLLRRAPKFLNKSRSTVVELSKPPLSHRNSNGL
Download sequence
Identical sequences A0A094LDP0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]