SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094QRB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094QRB7
Domain Number 1 Region: 73-135
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000366
Family NfeD domain-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A094QRB7
Sequence length 137
Comment (tr|A0A094QRB7|A0A094QRB7_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:KGA17211.1} OX=449393 OS=freshwater metagenome. GN=GM50_12260 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
MWFAAAGGLLVIEMLTVDLLFASLAFSALLAAGANALGFNFVVQGVVFGVGAAGSILLLR
PIALRHLKKKPADYATNVEALLGAPAVALTEITDISGQVKLSGETWSAQSYTGTISEGSR
CEVTAIEGATAIVKKKG
Download sequence
Identical sequences A0A094QRB7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]