SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094TEG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094TEG7
Domain Number 1 Region: 7-74
Classification Level Classification E-value
Superfamily MbtH-like 6.54e-28
Family MbtH-like 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A094TEG7
Sequence length 76
Comment (tr|A0A094TEG7|A0A094TEG7_YERFR) MbtH-like family protein {ECO:0000313|EMBL:KGA48746.1} KW=Complete proteome OX=349966 OS=Yersinia frederiksenii ATCC 33641. GN=DJ58_4258 OC=Yersiniaceae; Yersinia.
Sequence
MNNETQINPFDNEDLPFLVLSNEQQQYSLWPQITAIPAGWEKVYGPQTRADCVKYLEANW
TDMRPASLIRAEADQQ
Download sequence
Identical sequences A0A094TEG7
WP_032911217.1.48104 WP_032911217.1.94615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]