SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094ZC72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094ZC72
Domain Number 1 Region: 54-183
Classification Level Classification E-value
Superfamily PAP/Archaeal CCA-adding enzyme, C-terminal domain 5.1e-21
Family Poly(A) polymerase, PAP, C-terminal domain 0.00026
Further Details:      
 
Domain Number 2 Region: 1-51
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.000000000314
Family Poly(A) polymerase, PAP, middle domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A094ZC72
Sequence length 184
Comment (tr|A0A094ZC72|A0A094ZC72_SCHHA) Poly(A) polymerase gamma {ECO:0000313|EMBL:KGB31387.1} KW=Complete proteome; Reference proteome OX=6185 OS=Schistosoma haematobium (Blood fluke). GN=MS3_10823 OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MPILTPSYPSQNSTYNVQRSNRIIIERELKQGLNVVRASMMHKGSWSNLFEAAFFFQYRH
YVVVIVVGNTKHTFIELCGLVESRLRVLVSNFEVNRYVKMAHVNCHAYGKGPNDDDANFV
RKWFIGMEFDRNTNSLTSTVHNSNVSSDKATLNVDLSENISSFEKSIERGLSSEDLSVTV
KYVK
Download sequence
Identical sequences A0A094ZC72
XP_012802055.1.65645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]