SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094ZRQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094ZRQ6
Domain Number 1 Region: 721-850
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.96e-43
Family Regulator of G-protein signaling, RGS 0.00000317
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A094ZRQ6
Sequence length 856
Comment (tr|A0A094ZRQ6|A0A094ZRQ6_SCHHA) Regulator of G-protein signaling 20 {ECO:0000313|EMBL:KGB36832.1} KW=Complete proteome; Reference proteome OX=6185 OS=Schistosoma haematobium (Blood fluke). GN=MS3_05149 OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MLNGPTVLLKNSTTSLCNPVINNLSSRSSSSLTSTNNNNTNHNHNDNDQIKPDLSQSSSC
LSTTLFTNYSMHPIHNHSIYTTNLSSSINYDNTITLNHHNQAYQLSDSLKRTNFNCPNDT
LFINQVIKDKIKSSEQLTSTIMIKNDDIIQIRRRLPPLGKSDSSETGLQINNNNNETNSS
IVTTATKIVIEADPNDKNSNNNDNIGQHKTIEGDISNEEITSEKMLQSQSDSVNIEHNEL
TKSTIPISSYSSLRDIDNDQNMCRYCHNRLPSCTHQLNLLQPTITTTNFNNNNNSLSTGM
MGTRQKSTSAIPSSSTYEIRPNTTGKLSEYKHESYDPLSNHDNHSYYYNNINHHNDIDNS
KLLFPANFCHDNLHIITPSQCSINYVTNVQCSSPSSSNLAYHELNQSNLPYTTSITTTTT
TTTTTTNTTTTNNNISSMNENNHVQSLNYLYSETFNASNRLNTHCDRRNYTRETLLIHTD
NSIDNNNNNSNNHTKSCIKTDRSHSESISGPFQRISLYFTNDTQNNNNNNTNSNNDNNNK
EKPQHYKSIIRNSIPSYSILRGTLRSYISEATYKTSSNRNIKTINHQHTITVPIDSTNSC
QASLIPINNNNNNNNNNNNNGSNNKSTKHTNEHFDTIIEDKHNEEMIVNNEVSTIRRSLN
STTNTNQIIQDPRSRTCCFCWCCCCSCSCMRVRANLGESKRPSASNDPQSTVDCQISDEK
VTLEELEKWAESFDILMRSSSGQKTFREFLRSEYSEENIMFWLACEDIRKESNLEIVEEK
ARIIYEDFISILSPREVSLDSRVREIINSNMIEPTPHIFDEAQLQIYTLMHRDSYPRFLN
SKLYKDMIEEMKNGQS
Download sequence
Identical sequences A0A094ZRQ6
XP_012796594.1.65645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]