SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095ARZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095ARZ8
Domain Number 1 Region: 276-410
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.01e-40
Family Regulator of G-protein signaling, RGS 0.0000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A095ARZ8
Sequence length 582
Comment (tr|A0A095ARZ8|A0A095ARZ8_SCHHA) Regulator of G-protein signaling 5 {ECO:0000313|EMBL:KGB37156.1} KW=Complete proteome; Reference proteome OX=6185 OS=Schistosoma haematobium (Blood fluke). GN=MS3_05481 OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MRFVCEDIYDKRLRSFGEMFICKITDRNITSQYASTNNFKMGKTFHTEQAKDQQASSSSP
TPFQQTVNETATVTNAGQLSRSGFLRHPLRKAMSYVKPQSESFVSVKSASRRLHHTSTIE
KPDDPKFRSSSKSSSRNSFYNNIKHFDLSTKPTNECLQMNDHSNRSTIQEVYTGESCYST
TPKQAIKIDVERKTKQKDIRHLNDLITNILPRSFSNAFRRPVGKCKSASPTIVNDHHIEK
LIDSFRFDNFEVESQHSEKSPSDLLTPNEASPVLNEHNVPTRSQLQQWEQSFDKLLADTD
GLSQFHHFLRSEYSEENIEFWLICELYKHLPQEDLGEESRRIYRLYLAPHSPHEVNLDSE
TRNQTIASITNPTNESFILAQQTIQGLMNKDSYQRFLRSSFYFELKQLVWHTYPENDEPT
NSESNIHDTIISNNQTQYFISRDPITDNTSSPCSEEEHVKEFLRSPSVSYSTISSPKQTA
ASHETNLESHIQPSKTIPSPLLDCTVSSLFHKHIEDDEELSFHENIIEHPTSTQTNDNLS
IQELPNSVHTEAAPHSPKLCYTGYTLSNTDCYKLKQNIRSEL
Download sequence
Identical sequences A0A095ARZ8
XP_012796918.1.65645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]