SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095AWQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095AWQ2
Domain Number 1 Region: 20-175
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 1.44e-64
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.000000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A095AWQ2
Sequence length 179
Comment (tr|A0A095AWQ2|A0A095AWQ2_9PROT) 5-(carboxyamino)imidazole ribonucleotide mutase {ECO:0000256|HAMAP-Rule:MF_01929} KW=Complete proteome OX=104102 OS=Acetobacter tropicalis. GN=AtDm6_2824 OC=Acetobacteraceae; Acetobacter.
Sequence
MSETSPLPAATSQTTTPEPKVGIIMGSQSDWDTMRHADAILTELEIPHETLIVSAHRTPD
RLADYAKSAAGRGLSVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQ
MPGGIPVGTLAIGSSGAKNAALLAAAILALQEPELAARLEAWRALQTASVANTPMTDEE
Download sequence
Identical sequences A0A095AWQ2 A0A0U5EQD1
WP_081939114.1.23839 WP_081939114.1.48538 WP_081939114.1.50801 WP_081939114.1.74990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]