SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095BKJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095BKJ2
Domain Number 1 Region: 21-198
Classification Level Classification E-value
Superfamily Lipocalins 1.58e-26
Family Rv2717c-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A095BKJ2
Sequence length 214
Comment (tr|A0A095BKJ2|A0A095BKJ2_9SPHN) Uncharacterized protein {ECO:0000313|EMBL:KGB51536.1} KW=Complete proteome; Reference proteome OX=1120705 OS=Sphingopyxis sp. LC363. GN=FG95_03783 OC=Sphingomonadaceae; Sphingopyxis.
Sequence
MELPADIFTEPEDVDPETLANLGPLRRLAGIWEGQRGVDINPKADGPETREYYERIELQP
IDPQANGPQLFYGLRYHLHVNTREEDIAFHDQVGYWLYEASTGLILQTLAIPRGQIAIAA
GHAAPDAKQLVVKAERGQTEYGICSTSFLELAFRTDAYQLTVDFHDDGSWSYVSDTTLMV
KGKGEPFLHRDRNRLTKIAEPDLNPWAKIVRGAA
Download sequence
Identical sequences A0A095BKJ2
WP_037557870.1.57869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]