SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095BR00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095BR00
Domain Number 1 Region: 26-67
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000675
Family Ovomucoid domain III-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A095BR00
Sequence length 79
Comment (tr|A0A095BR00|A0A095BR00_9SPHN) Protease inhibitor Kazal-type {ECO:0000313|EMBL:KGB53426.1} KW=Complete proteome OX=1502850 OS=Sphingopyxis sp. LC81. GN=FG91_02672 OC=Sphingomonadaceae; Sphingopyxis.
Sequence
MKISALPAIGFVTIFLTTGCMENMPRPERPGPERPIACTQEYAPVCAVKRGKRKTFSNAC
MARAERYTVISGQACNSTQ
Download sequence
Identical sequences A0A095BR00
WP_052187581.1.4235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]