SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095C4S5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095C4S5
Domain Number 1 Region: 216-335
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.14e-33
Family cAMP-binding domain 0.00000174
Further Details:      
 
Domain Number 2 Region: 341-463
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.31e-31
Family cAMP-binding domain 0.00000444
Further Details:      
 
Domain Number 3 Region: 8-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 2.62e-16
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A095C4S5
Sequence length 478
Comment (tr|A0A095C4S5|A0A095C4S5_SCHHA) cAMP-dependent protein kinase regulatory subunit {ECO:0000313|EMBL:KGB36828.1} KW=Complete proteome; Reference proteome OX=6185 OS=Schistosoma haematobium (Blood fluke). GN=MS3_05139 OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MEDESFMSDVEDYVKQHNVHEILRDCVVNLCLHRPSNPIAFLREYFEKLEVCNGKCSAAS
TSHVTGFAFHKHSERNENSHTFPISNTSSRPFQNEVKSHGSGCFGVIIPSVSSQNCGQSS
EMNNHRCSCDTDNLIPNTLEKSLTETPLKVDSSYEPNNMNEDGSSYDGGNSGGTRGLLAV
SPSGVSLTRRRSRRGAVSGEVYTEEDAASYVKKVVPKDYKTMTALSKAIAKNVLFSHLDE
TERSDIFDAMFPVHRNSGDVIIQQGDEGDNFYIIDQGEVDIFLNNEYSSTIGEGGSFGEL
ALIYGTPRAATVRAKTEVKLWGIDRDSYRRILMGSTIRRRKVYQEFLCRVPILDNLDKWE
RLTVADALEPVRFEDGEVVVRQGEHGDDFFIITEGTAAVLQRPSESGEQVEVGKLRPSDY
FGEIALLLDRPRAATVVAQGTLRCVKLDRKRFERVMGPCSDILKRNIAKYNSYISLSV
Download sequence
Identical sequences A0A095C4S5
XP_012796590.1.65645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]