SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095C9Q3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095C9Q3
Domain Number 1 Region: 114-191,218-278
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000837
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A095C9Q3
Sequence length 836
Comment (tr|A0A095C9Q3|A0A095C9Q3_CRYGR) Glucan synthesis regulatory protein {ECO:0000313|EMBL:KGB77167.1} KW=Complete proteome; Reference proteome OX=294750 OS=(Cryptococcus bacillisporus). GN=CNBG_3005 OC=Cryptococcus gattii species complex.
Sequence
MPFLQSISSLFSGNSSKSNQSHYNNGRSVMNSTHDAFSLPTTNSGNMNYGNGYNDGLQLD
SASSSPGPSRRASNAYNNNDPTKDFPANPNSYPPLTHTFHRLRKSLAGSFPELLETLNPP
ANPDLLATFEVELGCPLPRSVRESIQVADGQDLEATGSISGSGGLFYGLYFLPLEEVMRE
WAFWRYAEDDPTVGGNPAILATMASVPPQWIKTVYACKGWVPLLSDRTGNYVGVDLDPGA
NGAWGQVIVFGRDFDRKCVLWKGDGEGGWGKWLAAFVDELESGKGWEADKAASSDEEEEI
GYSSYNGGGTYGEAGSGLRLAGEYRGWNVLEAWWDRSVRKWESLGLGLDIEEVEKGLEEA
RRLTGYGVSATEGKGKGKAREGINGGTSNSNTPPQETLGGSPHLATVPGTPVPHDSDVLL
PPSSPEQPPIPKIRHPSPSPVRVITPVTSTTDHPLKPEPSSTVSGSGSGSGYLSPPTHSP
PRRKRAPAPVPTPIDLPTRADIQAMSAIAQAETSGLRGGWVMNLDTSVGSAARRASRLSS
LGSGSQGRASMDAEMVDIDLEGGRAVPFGSPHMTEDELDKQREEERMAHAGLEHRRSPVM
LTSRTPSPLARSPHSSHSPLSPHSASFHSPQSAHSASLHSPHSPYSSRSPSFETRSITTT
IEDPSREKTPKASLRPPSSQSPLDVAAIPQSVLDATSMIRPPPPVANNSSLTIRGYDGEE
KDRSLVRANSGASNGRRSPRPERSGTTPTPGSGPTQQRQMTRDQRESSVVSTDSRDGLLE
SGSYRRSASPVSVSDASTLEGEEVMESPSRIKSMESGHQGKEGKTKLEEEFQEVSL
Download sequence
Identical sequences A0A095C9Q3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]