SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095CBA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095CBA4
Domain Number 1 Region: 63-113
Classification Level Classification E-value
Superfamily LigB-like 0.000000000275
Family LigB-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A095CBA4
Sequence length 134
Comment (tr|A0A095CBA4|A0A095CBA4_CRYGR) Uncharacterized protein {ECO:0000313|EMBL:KGB76889.2} KW=Complete proteome; Reference proteome OX=294750 OS=(Cryptococcus bacillisporus). GN=CNBG_2727 OC=Cryptococcus gattii species complex.
Sequence
MSRWSPALWAITIFFAIIAIQAFQARIASYTTKGVQSAIKDHAFREQAFSTMTAANASKV
GDVYFLSHGGPPTIEQYDSAPYEGWRKFGRILKANPPKGIVVVSAHWENQGAFRSGVIGC
KGFERRWNHCQQGQ
Download sequence
Identical sequences A0A095CBA4 A0A0D0TZT5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]