SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095CBN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095CBN6
Domain Number 1 Region: 137-275
Classification Level Classification E-value
Superfamily ISP domain 1.44e-40
Family Rieske iron-sulfur protein (ISP) 0.00000364
Further Details:      
 
Domain Number 2 Region: 96-151
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 0.0000000000000959
Family ISP transmembrane anchor 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A095CBN6
Sequence length 281
Comment (tr|A0A095CBN6|A0A095CBN6_CRYGR) Ubiquinol-cytochrome c reductase, iron-sulfur subunit {ECO:0000313|EMBL:KGB77940.1} KW=Complete proteome; Reference proteome OX=294750 OS=(Cryptococcus bacillisporus). GN=CNBG_4027 OC=Cryptococcus gattii species complex.
Sequence
MAAHIGRINLLPTTRTLASGAPLARGISLAVPAAGDAHSHGHDGHEGPRPDIPAAWAFKA
GARGHIGRTNALPTTPSFQQRFLSTTRNVPAAASSSATDVPDFSPYRAKNPNTTRNVSYF
MVGALGALGASSVKSTAVDMLSNMAASADVLALAKIEVEMGAIPEGKNLIVKWRGKPVFI
RHRTPDEIEEANSVDVKSLRDPETDEQRTQRPEWQVLVMVGVCTHLGCVPIGEAGDYGGW
FCPCHGSHYDISGRIRRGPAPLNLEIPEYTFNDDEEKIVVG
Download sequence
Identical sequences A0A095CBN6 A0A0D0UZ12

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]