SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095CF29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095CF29
Domain Number 1 Region: 5-102
Classification Level Classification E-value
Superfamily Signal recognition particle alu RNA binding heterodimer, SRP9/14 4.19e-24
Family Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A095CF29
Sequence length 171
Comment (tr|A0A095CF29|A0A095CF29_CRYGR) Signal recognition particle subunit SRP14 {ECO:0000313|EMBL:KGB78847.1} KW=Complete proteome; Reference proteome OX=294750 OS=(Cryptococcus bacillisporus). GN=CNBG_4685 OC=Cryptococcus gattii species complex.
Sequence
MPQNLVSPEEFLTKLGQCFSDPSSSSSVWLTHKRLTYSDDADVQMNDEEGENGGEAPEHE
VLIRCTQGDNKFSARVPASSVPSFHAAYGSLLKTSMAPLMRKRDKKKEKARAEALTKKRK
ELYVDVVIGNEGKRGKGRRQRQRKIVAQKKKEAERERLEIKQAQQKASGDL
Download sequence
Identical sequences A0A095CF29

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]