SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095CFP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095CFP8
Domain Number 1 Region: 10-38,164-206
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000235
Family Regulator of G-protein signaling, RGS 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A095CFP8
Sequence length 493
Comment (tr|A0A095CFP8|A0A095CFP8_CRYGR) Uncharacterized protein {ECO:0000313|EMBL:KGB78269.1} KW=Complete proteome; Reference proteome OX=294750 OS=(Cryptococcus bacillisporus). GN=CNBG_3831 OC=Cryptococcus gattii species complex.
Sequence
MVKRAPAISFADFATFLTNKDYTSENLVFVLWHRDYKSKWKLLDKAVRIRGPVPSTSLGH
RYDPFGYLRHGPVALPTRTGEREEEVSRNRLASANAYSMDATAASDRNDRSAKPLKSYFS
RVSSDLHRSRLEASSLACSSSLTPASSYHPLHSLFSPDGTTFLSVDEQPLRDQAQRAFVT
FLKKGGSKELSISDELREYVRSCLEASTAPEYCVGAVDLLIGLTIFLLLTLLLPPSPFSL
RIYRLFSAIFVSFGIMQVYSAYRGFCSQVWRRSNRQVWPWDLDALEDENAKVGDTMGRSD
IIGYEPKPQVRVLQKTVLPGEVRPLSNLGAIESFDSTCKVNIQVSENSTSASQTSLDNSG
GYDIPSQTFDSCNDIAGEFVSECHNSSLGGKLGSISRPCCMRHAILTAKGHKLPIHIQRK
ISPFAFESGREGETGSDNATVTKPPPHSASTQVINALTSSTLIQIFRLWSTKPKYLQGGK
IIGRFTFLVPKTG
Download sequence
Identical sequences A0A095CFP8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]