SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095D9H2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095D9H2
Domain Number 1 Region: 7-124
Classification Level Classification E-value
Superfamily YdhG-like 0.00000000000000288
Family YdhG-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A095D9H2
Sequence length 132
Comment (tr|A0A095D9H2|A0A095D9H2_9SPHN) Uncharacterized protein {ECO:0000313|EMBL:KGB55873.1} KW=Complete proteome; Reference proteome OX=1120705 OS=Sphingopyxis sp. LC363. GN=FG95_02516 OC=Sphingomonadaceae; Sphingopyxis.
Sequence
MAADLIDAKIAGLGDWRGDTLAKLRALIHAADAQVEETVKWQKPSNPAGVPVWEHAGILC
TGETYKDKVKLTFAKGAALADPKKLFNSSLDGNTRRAIDLFEGDSIDEAAFKALIRAAVE
ANLEKPARVKKA
Download sequence
Identical sequences A0A095D9H2
WP_037556298.1.57869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]