SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095DG92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095DG92
Domain Number 1 Region: 64-80,113-159
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0000000000432
Family AN1-like Zinc finger 0.0023
Further Details:      
 
Domain Number 2 Region: 6-57
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00000000243
Family AN1-like Zinc finger 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A095DG92
Sequence length 294
Comment (tr|A0A095DG92|A0A095DG92_CRYGR) Uncharacterized protein {ECO:0000313|EMBL:KGB79716.1} KW=Complete proteome; Reference proteome OX=294750 OS=(Cryptococcus bacillisporus). GN=CNBG_5554 OC=Cryptococcus gattii species complex.
Sequence
MTTSTPESRSEMMFLGQECNHPACYLHDFLPFNCPACHLAFCQPHFLPSQHSCTAPLPAS
MIDRIAPTCPMCNEIVPYPKSMDPNEAVERHIMSGTCVGLQGGEERKKAEAKRRRDIGEV
CWKKSCGKVLIVKMKCESCQHVFCPTHRHPTSHTCSDQTPSPSSSSSRLGNPQTPSTSRP
AGKAALSRLLPPSMQPPASTEASRSIPPVKVNSANTTLGGSKPLAASSEGNVGSNLDAKA
AAAAAALKRAGQDVKVPFVKSSAEKRTQAEVNSQIQALKARHEKGLLTKTEQVR
Download sequence
Identical sequences A0A095DG92 A0A0D0V2X1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]