SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095FG56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095FG56
Domain Number 1 Region: 88-212
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.9e-44
Family PH0987 C-terminal domain-like 0.000012
Further Details:      
 
Domain Number 2 Region: 5-92
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 7.59e-16
Family PH0987 N-terminal domain-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A095FG56
Sequence length 218
Comment (tr|A0A095FG56|A0A095FG56_BURGA) Allophanate hydrolase subunit 1 family protein {ECO:0000313|EMBL:KGC16666.1} KW=Complete proteome OX=28095 OS=Burkholderia gladioli (Pseudomonas marginata) (Phytomonas marginata). GN=DM48_4384 OC=Burkholderiaceae; Burkholderia.
Sequence
MTAPRLYPLGDTALVCEAPPPATLDCQRRIWAVAALARGWPQVLDVVPGMNNLTVVFDPF
ETSAAALLPRLEAAWREADPDAAPGREVEIPVIYGGEAGPDLAAVAAHTGLAAREVVERH
AAGSYIVFFLGFQPGFAYLGGLEAALHTPRRTAPRLEVAAGSVGIGGAQTGIYPASAPGG
WQLIGRTALPLFDPAQTPPTLLQPGDRVRFTVREVQAS
Download sequence
Identical sequences A0A095FG56
WP_036048883.1.1979 WP_036048883.1.34339 WP_036048883.1.40080 WP_036048883.1.51104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]