SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095GKK1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095GKK1
Domain Number 1 Region: 9-148
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 4.81e-33
Family PA0094-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A095GKK1
Sequence length 156
Comment (tr|A0A095GKK1|A0A095GKK1_BURGA) Uncharacterized protein {ECO:0000313|EMBL:KGC17797.1} KW=Complete proteome OX=28095 OS=Burkholderia gladioli (Pseudomonas marginata) (Phytomonas marginata). GN=DM48_3396 OC=Burkholderiaceae; Burkholderia.
Sequence
MTDSDNRIRIHEGSIALPAGFEDRTTNLFVPADLAAQPNLSVARDWLKDGEALDAYVDRQ
SGLLKSRLQGYRLVARAAERLGAQDGGIAGERIDTAYRNGAKTVFQRQAAFVVAPGRVLI
FTASSGRSFGDTYNALWRDWLDSYRPDAPEPAPNQA
Download sequence
Identical sequences A0A095GKK1
WP_036047936.1.34339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]