SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095SHL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095SHL0
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.36e-38
Family SMI1/KNR4-like 0.00000807
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A095SHL0
Sequence length 135
Comment (tr|A0A095SHL0|A0A095SHL0_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KGD64032.1} KW=Complete proteome OX=1177154 OS=Alcanivorax nanhaiticus. GN=Y5S_02800 OC=Alcanivoracaceae; Alcanivorax.
Sequence
MEDVIELLRERHQGGLVALELPDEDRLVEIEEQLLIPLPGDYKEFLLNASDILCGSLEPA
TVMDDYAHNFLPEMAANAWDQGMPRYLIPVCEAPNGIYAMSQEGAVLLWVPGAGISEEEE
WGSIWQWAREVWLES
Download sequence
Identical sequences A0A095SHL0
WP_035233823.1.69688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]