SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095SJW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095SJW4
Domain Number 1 Region: 6-101
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000706
Family SMI1/KNR4-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A095SJW4
Sequence length 121
Comment (tr|A0A095SJW4|A0A095SJW4_9GAMM) Cell wall assembly/cell proliferation coordinating protein, KNR4-like protein {ECO:0000313|EMBL:KGD64956.1} KW=Complete proteome OX=1177154 OS=Alcanivorax nanhaiticus. GN=Y5S_01864 OC=Alcanivoracaceae; Alcanivorax.
Sequence
MNIEKFSEFLKSIEGLASNYPSIYEGDSLISLSLYFWSWDEILDGLEKRDEWEISDNLIP
FYGDWHDLFCLNTDDGKIVSINDDREIHFQWNDSANFISSLSSKEIESPKSTGIVSGQLD
F
Download sequence
Identical sequences A0A095SJW4
WP_035232454.1.69688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]