SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095SLM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095SLM8
Domain Number 1 Region: 1-139
Classification Level Classification E-value
Superfamily Ribosomal protein L13 1.57e-62
Family Ribosomal protein L13 0.000000602
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A095SLM8
Sequence length 142
Comment (tr|A0A095SLM8|A0A095SLM8_9GAMM) 50S ribosomal protein L13 {ECO:0000256|HAMAP-Rule:MF_01366, ECO:0000256|RuleBase:RU003878, ECO:0000256|SAAS:SAAS00725370} KW=Complete proteome OX=1177154 OS=Alcanivorax nanhaiticus. GN=Y5S_01385 OC=Alcanivoracaceae; Alcanivorax.
Sequence
MKTYSAKPESVKRDWYVVDASGKTLGRLATEVASRLRGKHKPEYTPHVDTGDYIVVINAD
KVAVTGNKANDKMYYRHTGYPGGLKEANFATLQAEKPEMIIEKAVKGMLPRNPLGRAMYR
KLKVYAGTEHPHTAQQPQQLEI
Download sequence
Identical sequences A0A095SLM8
WP_035231612.1.69688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]