SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095VD43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095VD43
Domain Number 1 Region: 4-144
Classification Level Classification E-value
Superfamily Ribosomal protein L13 3.92e-58
Family Ribosomal protein L13 0.00000492
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A095VD43
Sequence length 154
Comment (tr|A0A095VD43|A0A095VD43_9RHIZ) 50S ribosomal protein L13 {ECO:0000256|HAMAP-Rule:MF_01366, ECO:0000256|SAAS:SAAS00766472} KW=Complete proteome; Reference proteome OX=1532558 OS=Rhizobium sp. YS-1r. GN=JL39_13375 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MSTFVQKPAEVEKKWVIIDAEGLVVGRLATIVANRLRGKHKATYTPHVDDGDNVIVINAE
KVALTGKKYSDKKYYWHTGYPGGIKERTARQIIEGRFPERVIEKAVERMIPRGPLGRRQM
KNLRVYAGSNHPHEAQQPVALDVASLNKKNVRSA
Download sequence
Identical sequences A0A095VD43
WP_037150730.1.68289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]