SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095XUH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095XUH5
Domain Number 1 Region: 1-98
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.73e-36
Family Ribosomal proteins L24p and L21e 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A095XUH5
Sequence length 101
Comment (tr|A0A095XUH5|A0A095XUH5_9FIRM) 50S ribosomal protein L24 {ECO:0000256|HAMAP-Rule:MF_01326} KW=Complete proteome OX=1219626 OS=Peptostreptococcus sp. MV1. GN=HMPREF1639_03375 OC=Peptostreptococcaceae; Peptostreptococcus.
Sequence
MRVKKGDTVVVIAGKDKGKKGLVLSVDAKNDKVLVEGINIATKHNKPSATNPQGGITTKE
APIHISNVMPFDPESGKGVRVRYEVKDGKKVRVSAKSGKEL
Download sequence
Identical sequences A0A095XUH5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]