SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095YCG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095YCG6
Domain Number 1 Region: 26-130
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 5.62e-32
Family N-utilization substance G protein NusG, N-terminal domain 0.00019
Further Details:      
 
Domain Number 2 Region: 138-192
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000000000000221
Family N-utilization substance G protein NusG, C-terminal domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A095YCG6
Sequence length 192
Comment (tr|A0A095YCG6|A0A095YCG6_9FIRM) Transcription termination/antitermination protein NusG {ECO:0000256|HAMAP-Rule:MF_00948, ECO:0000256|RuleBase:RU000538, ECO:0000256|SAAS:SAAS00126873} KW=Complete proteome OX=1284686 OS=Anaerococcus lactolyticus S7-1-13. GN=HMPREF1630_04475 OC=Anaerococcus.
Sequence
MTDSLNFETNKEEEKEALLTEIEKKARWYVVHTYTGYENRVADKIQMMIDNEQNPDIVDV
TVPTEEYVEVKNNDKKVKTRKLFPGYVMVKMNVTSKSWYIIRNTQGVTGFVGPDGDPVPL
TKAEVRKFGVKEKEPVLNIKVKPGDDVNIIAGPFKDFVAKIDEIDNEKGIIKAYVDMFGR
DTLIDLEYSDIE
Download sequence
Identical sequences A0A095YCG6 C2BIH1
WP_004828829.1.41671 WP_004828829.1.47035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]