SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095Z3E1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A095Z3E1
Domain Number - Region: 90-129
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.00405
Family PspA lactotransferrin-binding region 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A095Z3E1
Sequence length 138
Comment (tr|A0A095Z3E1|A0A095Z3E1_9BACT) Uncharacterized protein {ECO:0000313|EMBL:KGF29163.1} KW=Complete proteome OX=1236504 OS=Prevotella histicola JCM 15637 = DNF00424. GN=HMPREF2132_03350 OC=Prevotella.
Sequence
MRRLFLITIMTLITVCGFSQSNTTVNNLKDQQKVLDLTAKLNKMQLDYEKKKLECDALSN
KAAGINADANTATTDFNAGDPASTVKDAKDTVKKLEATKDVNKKLAKSQKELSKMEKKIA
KLQDKLDQLNKKVEIINK
Download sequence
Identical sequences A0A095Z3E1 G6AFH6
WP_008822695.1.323 WP_008822695.1.68759 WP_008822695.1.87228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]