SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095Z9F9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095Z9F9
Domain Number 1 Region: 22-204
Classification Level Classification E-value
Superfamily VC0467-like 5.63e-53
Family VC0467-like 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A095Z9F9
Sequence length 204
Comment (tr|A0A095Z9F9|A0A095Z9F9_9BURK) UPF0301 protein HMPREF2130_03590 {ECO:0000256|HAMAP-Rule:MF_00758} KW=Complete proteome; Reference proteome OX=1401065 OS=Oligella urethralis DNF00040. GN=HMPREF2130_03590 OC=Alcaligenaceae; Oligella.
Sequence
MGSFDKQHSSSDERNVEHFTDLSGQFLLAMPGVDSDLFNGTVIYLFEHSPEGAGGVIVNR
ATDIELSDLVERFELEAPADYVNKTIFFGGPVQPMRGFVLHPPLKTADDDGTTSHKDELL
QISNSSDMLQDYLLGKGPEDVFICFGYAGWDEGQLERELRENVWLTVPADHDLIFKRPPY
DCYQAALASLGIDISHLSTQAGHA
Download sequence
Identical sequences A0A095Z9F9
WP_036558168.1.87501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]