SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096AE18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096AE18
Domain Number 1 Region: 6-138
Classification Level Classification E-value
Superfamily Ribosomal protein L13 5.76e-46
Family Ribosomal protein L13 0.0000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096AE18
Sequence length 154
Comment (tr|A0A096AE18|A0A096AE18_9BACT) 50S ribosomal protein L13 {ECO:0000256|HAMAP-Rule:MF_01366, ECO:0000256|SAAS:SAAS00766472} KW=Complete proteome OX=1236504 OS=Prevotella histicola JCM 15637 = DNF00424. GN=HMPREF2132_03555 OC=Prevotella.
Sequence
MDTLSYKTISVNKETAKKEWVVIDASDQIVGRLCSKVAKLLRGKYKPTFTPHVDCGDNVI
IINAAKVVFSGKKETDKVYTRYTGYPGGQRFNTPAQLRTRKNGIDKMIRHAVKGMLPKGP
LGRHLLDNLYVIDGTELNGLEAQKPKAIDINQYK
Download sequence
Identical sequences A0A096AE18 G6AHS1
WP_008823558.1.323 WP_008823558.1.68759 WP_008823558.1.87228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]