SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096AUU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096AUU6
Domain Number 1 Region: 128-268
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 3.77e-49
Family AadK C-terminal domain-like 0.000059
Further Details:      
 
Domain Number 2 Region: 1-124
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.57e-38
Family AadK N-terminal domain-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096AUU6
Sequence length 272
Comment (tr|A0A096AUU6|A0A096AUU6_9FIRM) Aminoglycoside adenylyltransferase {ECO:0000313|EMBL:KGF34357.1} KW=Complete proteome; Reference proteome OX=1401070 OS=Peptoniphilus lacrimalis DNF00528. GN=HMPREF2134_05635 OC=Peptoniphilus.
Sequence
MRTDQEMLELILGTAKKLQVDAVALSGSRTDTKAPKDEFQDYDVVYVVDDLDNLTSDLAW
LDQFGARIIEQHNILGNRRLYLMLFEDGNRIDLTLCPKDYINEWVDSEAGFTVLEDKKGI
FETYSPSPQRYWTAPASATDFDKSCNEFWWVSTYVVKGICRNQLIYATDHLYGICQQELL
KILAWQVASDREAVDIGKNYKYLFNYLTAEKEKEFSNLLDFSSLDKIIQSLSATMQLFHQ
EAQSLAQKMDFKYEKEVAEKMMRYAEENLLNH
Download sequence
Identical sequences A0A096AUU6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]