SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096B801 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096B801
Domain Number 1 Region: 41-169
Classification Level Classification E-value
Superfamily Ferritin-like 4.41e-39
Family Ferritin 0.0000705
Further Details:      
 
Domain Number 2 Region: 176-216
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0000000000834
Family Rubredoxin 0.0056
Further Details:      
 
Domain Number 3 Region: 3-36
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.000000000488
Family Rubredoxin 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096B801
Sequence length 217
Comment (tr|A0A096B801|A0A096B801_9BACT) Rubrerythrin {ECO:0000313|EMBL:KGF38902.1} KW=Complete proteome OX=1401077 OS=Prevotella denticola DNF00960. GN=HMPREF2139_11235 OC=Prevotella.
Sequence
MKQKFICTVCGYIHEGTEAPAECPVCHAKASKFKAFNPAALKGTKTEQNLKDAFAGESQA
HTKYLYYASKAKKDGYEQIAGFFEETARNEKEHAKIWFKFLHGGDIPTTTENLADAAAGE
NWEWTDMYDQMAKDAEAEGFPELAVKFRGVGQVEKHHEERYRKLLKNIEDSVVFSRDGDC
IWQCRNCGHIVVGKKAPAVCPVCNHPQSFFQVQENNY
Download sequence
Identical sequences A0A096B801 F2KWE1
WP_013671782.1.35381 WP_013671782.1.94677 gi|327314165|ref|YP_004329602.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]