SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096LUE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096LUE6
Domain Number 1 Region: 361-546
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.19e-57
Family Regulator of G-protein signaling, RGS 0.0000109
Further Details:      
 
Domain Number 2 Region: 762-986
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-56
Family DBL homology domain (DH-domain) 0.000000046
Further Details:      
 
Domain Number 3 Region: 989-1123
Classification Level Classification E-value
Superfamily PH domain-like 6.96e-37
Family Pleckstrin-homology domain (PH domain) 0.00000957
Further Details:      
 
Domain Number 4 Region: 57-149
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-18
Family PDZ domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096LUE6
Sequence length 1128
Comment (tr|A0A096LUE6|A0A096LUE6_POEFO) Uncharacterized protein {ECO:0000313|Ensembl:ENSPFOP00000022787} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
AYKADSEKVHSFRPNNPGPPLSREELLDKRKKIRTSFLSLFDCEAVVQMCRDAINTWYSF
VVKMAGLVQRCVIIQRDKNGFGLTVSGDNPVFVQLVKEDADGAAMRAGVQTGDRIIKVNG
TLVTRSNHKEVVKLIKSGSYVALTVLGRPPGLSQMPLEETQEHNFLQVLPLHELTHTDGC
WKRQTLKLVFSTSNEITQTGKLLLCNLLVSNLQAIDNFYQLMYVFLESHHKILEHNLQAS
SANILSLYIKVSKKMQLASSANDLEYNVCAVLESNLLVKGKKCPTNYVSVLESNLQYQGI
IKTGSRSKTCSLMRVTCKDSSPHSSVASPPYTLNPQIIGAEDDYFDYQQEQVKPQINGEC
SCFQSIDLLKSRPAHLAVFLHHVVSQFEAAPLLCYLYAEMHKQTSSKESRRFFMEFHSLF
LDRTSNLKVPVPETIASELEKRRLELIPEDLCKQYTQVLQDSLLSDLLKNLEDFRQKRSM
GLTLAEDELSKLDLERGKDQPALEKECACAEHILAKIEDILQASEEEKCQAMQYVILTYM
KHLGVKVKEPRGLEQKRARITFLPKIKRGSKPEKDGDWKKPRFPNILVPPRRLSKVDSTL
VVKSVELNKQRSPKFSQPAFVIPEPADHPASNPGRSRANQLSQGSDTSTQSTISVASLGP
SSADLTGQETDSIHAGVSPFCIQSRLSDGLQAGEHQDGLSSPISTQFDFSPSGLDHREDD
QDAFRSILSGNRMEIQPTVGSADFQSEDDHAGEVESEEDPLNWQKLVPRGVLASLTSKEI
NRQEVINELFITERAHLRKLRVLDGVFCQRLSRHGVLPPDDIKRIFINLEEIIQLHFSIT
EQMAAVRKRSETSVIGQIGDDLLAWFSEEEEEKIKKATGTFCSNQPYALELIKTRQRFNL
FMQEAESNRLCRRLQLKDIIPVEMQRMTKYPLLLDNIAQYTEDGEEKEKVKKAGETCKKI
LNHVNQAVKEAENKQQRLVDYQRRLDVSSLKQIENPMILELRNLDLTKREMVYEGPLSWK
VNKDKTIELYTLLLEDIMVLLQKQDERLVLKFHGKNLTSIPDAKHSFSPVIKLSTVLVRP
VATDNKAFFVLSMSENGVQMYELMAQKVSDRRTWQCLITQCADAMKAK
Download sequence
Identical sequences A0A096LUE6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]