SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096LWY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096LWY2
Domain Number 1 Region: 107-230
Classification Level Classification E-value
Superfamily EF-hand 1.27e-51
Family EF-hand modules in multidomain proteins 0.00000282
Further Details:      
 
Domain Number 2 Region: 232-328
Classification Level Classification E-value
Superfamily EF-hand 1.41e-39
Family EF-hand modules in multidomain proteins 0.0000047
Further Details:      
 
Domain Number 3 Region: 308-396
Classification Level Classification E-value
Superfamily RING/U-box 2e-22
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 4 Region: 76-106
Classification Level Classification E-value
Superfamily WW domain 0.0000000136
Family WW domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096LWY2
Sequence length 452
Comment (tr|A0A096LWY2|A0A096LWY2_POEFO) Uncharacterized protein {ECO:0000313|Ensembl:ENSPFOP00000023673} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MNHLASTFDPSDIQLSPSNLERIEDLNTRWRLLQVTVDTGKSNSGSNGLDEVDSKISVKE
HLKQLTDAHTDFCLSQGSVERPFEQGISPNNVPYYINHQTQTTCWDHPKMTELYQSLADL
NNVRFSAYRTAMKLRRLQKALCLDLLSMQTACEVFEQHTLKQNEQLLDISQLVACLTSLY
QRLEQSHSHLVNVQLSVDMCLNWLLNVYDTGRTGKIRTLSFKTGIISLCKAHLEDKYRFL
FRQVASATGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPELEA
AMFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQ
SCFFSGRVAKGHKMQYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQ
TILEGDNMETWGSHTNTHTHTHIHTNTDKRHK
Download sequence
Identical sequences A0A096LWY2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]