SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096MDC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096MDC8
Domain Number 1 Region: 261-397
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.23e-35
Family cAMP-binding domain 0.00000309
Further Details:      
 
Domain Number 2 Region: 126-251
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.09e-31
Family cAMP-binding domain 0.00000192
Further Details:      
 
Domain Number 3 Region: 2-44
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000876
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096MDC8
Sequence length 406
Comment (tr|A0A096MDC8|A0A096MDC8_POEFO) Protein kinase, cAMP-dependent, regulatory, type II, alpha, B {ECO:0000313|Ensembl:ENSPFOP00000029419} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MSNVEIPAGLKELLQGYTVEVLRRRPPNLVEFAVQHFTRLLENQKNEQQARKSSSKPAAK
EVTFETASNKSNENDEEEERERKDKNDKSRYHPSIYTETHLCVSVCAEAYDPDDDADDNT
EPQVVHPKTEAQRQRLQDACKDILLFKTLEKEQFSEVLDAMFEVLVKPQDHIIDQGDDGD
NFYVIDKGVYDIFVAKDGVNVCVGKYNNKGSFGELALMYNTPRAATIVATEEGALWGLDR
ATFHRLIVKNNAKKRRTYEAFIECVPLLNCLELSERMKIVDVLGVRTFNDGDRIIAQGDK
ADCFYIVESGEVKILIKTKTKAGKQDNTEVEVARCSRGQYFGELALVTNKPRAASVYAVG
ETKCLVIDVQAFERLLGPCMDIMKRNISQYEDQLVALFGSSDDLKR
Download sequence
Identical sequences A0A096MDC8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]