SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096ME40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096ME40
Domain Number 1 Region: 108-192
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000025
Family Snake venom toxins 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096ME40
Sequence length 218
Comment (tr|A0A096ME40|A0A096ME40_POEFO) Sperm acrosome associated 4 like {ECO:0000313|Ensembl:ENSPFOP00000029681} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MYGSRGAPRSPTAFCKVTLTHIHLYRTHRTVKSARIAVTSRSRRWRDIKASMSEKLCSSH
NGLSFHRHAAPFLSPPPPSFYLFVFLDFSSKMNRIVFVFVAGLAFAVGQNLECYKCSIGL
WNLCLTSKTTCGTGEHCFSGEGGSGDVKLKMKGCLEVAKCNKTDDVKLPGTSNTTIYKMT
KTCCSTNLCNVAPGLPGASALSLAAVAMFSLLAANFMV
Download sequence
Identical sequences A0A096ME40
XP_007575947.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]