SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096MLX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096MLX4
Domain Number 1 Region: 46-173
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.89e-46
Family Regulator of G-protein signaling, RGS 0.00000814
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096MLX4
Sequence length 174
Comment (tr|A0A096MLX4|A0A096MLX4_PAPAN) Regulator of G protein signaling 5 {ECO:0000313|Ensembl:ENSPANP00000000578} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=RGS5 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
NLRHLLKLAKEIKIKLGILLQKPDSVGDIVIPYNEKPEKPAKTHKPSLDEALQWRDSLDK
LLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPK
EVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK
Download sequence
Identical sequences A0A096MLX4 A0A2K5Z6V1 A0A2K6LZJ7 A0A2K6NFD5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]