SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096MLY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096MLY2
Domain Number 1 Region: 119-159
Classification Level Classification E-value
Superfamily WW domain 0.000000000000757
Family WW domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096MLY2
Sequence length 400
Comment (tr|A0A096MLY2|A0A096MLY2_PAPAN) WW domain containing transcription regulator 1 {ECO:0000313|Ensembl:ENSPANP00000000586} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=WWTR1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGS
HSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDV
TDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSSTPVPQR
SMAVSQPNLVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRI
QMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVNPPTMTPDMRSITNNSSDPFL
NGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDF
LDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL
Download sequence
Identical sequences A0A096MLY2 A0A0D9RGG6 A0A2K5JLU4 A0A2K5N2E6 A0A2K6BDG1 A0A2K6L1W5 A0A2K6NR01 G3QDA0 G7MJI9 G7NZN0 H2PBQ5 H2R2X1 Q9GZV5
NP_001161750.1.87134 NP_001161750.1.92137 NP_001161752.1.87134 NP_001161752.1.92137 NP_056287.1.87134 NP_056287.1.92137 XP_003310184.1.37143 XP_003776382.1.23681 XP_003826526.1.60992 XP_004037881.1.27298 XP_005546133.1.63531 XP_008006937.1.81039 XP_010355141.1.97406 XP_011709189.1.29376 XP_011709190.1.29376 XP_011814328.1.43180 XP_011814329.1.43180 XP_011814330.1.43180 XP_011940924.1.92194 XP_011940935.1.92194 XP_011940944.1.92194 XP_014987274.1.72884 XP_016797636.1.37143 XP_016797637.1.37143 XP_016861610.1.92137 XP_016861611.1.92137 XP_017712042.1.44346 ENSGGOP00000000210 ENSPPYP00000015879 ENSPTRP00000044573 ENSP00000353847 ENSP00000419234 ENSP00000419465 ENSP00000353847 GO.35451 HR6406 ENSGGOP00000000210 ENSP00000353847 ENSP00000419234 ENSP00000419465 ENSPANP00000000586 gi|13346498|ref|NP_056287.1| gi|270132693|ref|NP_001161750.1| gi|270132744|ref|NP_001161752.1| ENSPPYP00000015879 9598.ENSPTRP00000044573 9600.ENSPPYP00000015879 9606.ENSP00000353847 ENSPTRP00000044573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]