SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096MP07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096MP07
Domain Number 1 Region: 20-154
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.37e-46
Family Regulator of G-protein signaling, RGS 0.0000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096MP07
Sequence length 159
Comment (tr|A0A096MP07|A0A096MP07_PAPAN) Regulator of G protein signaling 13 {ECO:0000313|Ensembl:ENSPANP00000001440} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=RGS13 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MSRRNCWICKMFRDESKRPPSNLTLEEVLQWSQSFENLMATKYGPVVYAAYLKMEHSDEN
IQFWMACETYKKIASRWSRISRAKKLYKIYIQPQSPREINIDNSTRQTIIKNIQEPTETC
FEEAQKIVYMHMERDSYPRFLKSEMYQKLLKTMQSNNSF
Download sequence
Identical sequences A0A096MP07

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]